PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN538901.1_FGP001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 626aa    MW: 71459.2 Da    PI: 6.7912
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN538901.1_FGP001genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3696.1e-1132566234374
               GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                        lL++cA+a++s+++  a++lL +++++a pdgd  qRla +f+ +L+arla+++s++y++l +++ts   + + l+a++l++ ++P+  +++
  KN538901.1_FGP001 256 LLIQCAQAIASNNHPFASELLRKIRHHALPDGDGSQRLANCFADGLEARLAGTGSQMYEKLMAKQTS---TRDMLKAYHLYFVACPFEMVTY 344
                        8****************************************************************99...899******************* PP

               GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                           N++I +a+eg++++Hi+Df+i  G+QWp+L+q La+R++gpp+lRiTgv+ p++g   +e++eetg+rLa++A+ ++vpf+++  +a+r
  KN538901.1_FGP001 345 YFSNKTIIDALEGKTTLHIVDFGIVFGFQWPCLIQRLAKREGGPPKLRITGVDVPQPGfrPRERIEETGKRLAEYANMFNVPFQYHG-IASR 435
                        *********************************************************9*****************************.7*** PP

               GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                        +e++ +e+L+++++E+l++n++ ++ +l de+ +++s+rd+vL+++k+++P+v+++   +  ++s+ Fl+rf e l +ys+lfd+l++++pr
  KN538901.1_FGP001 436 WETICIEDLSIDKDEVLIINCMSRMRKLGDETENIDSARDRVLHMMKRMNPQVFILGVVNGLYSSPFFLTRFREVLFHYSSLFDMLDNNVPR 527
                        ******************************************************************************************** PP

               GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                        ++e+ri vE+ l+g+++ n+vacegaer+er e++++W++r+ +aGFk+ p+++ + +   +  + +++d + ++e+sg+l++gWk+r + +
  KN538901.1_FGP001 528 NHEARILVEKDLFGNDALNAVACEGAERIERPESYKQWQMRILKAGFKQRPVNQAILNRSVHYKELYHED-FVIDEDSGWLLQGWKGRIIQA 618
                        ******************************************************9999999999999955.********************* PP

               GRAS 370 vSaWr 374
                        +S W+
  KN538901.1_FGP001 619 LSTWK 623
                        ****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.978227604IPR005202Transcription factor GRAS
PfamPF035142.1E-110256623IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 626 aa     Download sequence    Send to blast
MDSPEYCQAN SNITLDYING ILMEEDIDDK ISIKKGQDAL QATEKPFYDI LGKAYPSSSK  60
ETAINGDSRA DYPDNGISSY HEQACSGSFV SDLLGSQDAH SITTDWSSEF DRLALQFRRG  120
VEEAKRFIPN IEKLVDDPEK NGLYACKQTT ETTEQKGKHE NKIRNHPHVE DIELMEARNS  180
KHMAISTIET IRDEMFDSIL LCNRQLPGEV ANLRGKMAKE ASDNPKKFQS KGYGKGQRKP  240
HSSKKKQKEA IDLSVLLIQC AQAIASNNHP FASELLRKIR HHALPDGDGS QRLANCFADG  300
LEARLAGTGS QMYEKLMAKQ TSTRDMLKAY HLYFVACPFE MVTYYFSNKT IIDALEGKTT  360
LHIVDFGIVF GFQWPCLIQR LAKREGGPPK LRITGVDVPQ PGFRPRERIE ETGKRLAEYA  420
NMFNVPFQYH GIASRWETIC IEDLSIDKDE VLIINCMSRM RKLGDETENI DSARDRVLHM  480
MKRMNPQVFI LGVVNGLYSS PFFLTRFREV LFHYSSLFDM LDNNVPRNHE ARILVEKDLF  540
GNDALNAVAC EGAERIERPE SYKQWQMRIL KAGFKQRPVN QAILNRSVHY KELYHEDFVI  600
DEDSGWLLQG WKGRIIQALS TWKVET
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-472576238375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0790220.0AC079022.2 Oryza sativa chromosome 5 clone P0574H01, complete sequence.
GenBankAC0793560.0AC079356.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone P0016H04, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638488.10.0PREDICTED: scarecrow-like protein 9
TrEMBLI1PRT10.0I1PRT1_ORYGL; Uncharacterized protein
STRINGORGLA05G0007900.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP150538118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-171GRAS family protein